Comunique-se com o fornecedor? fornecedor
Amy Cheng Ms. Amy Cheng
O que posso fazer por você?
conversar Agora Fornecedor
Taizhou Volsen Chemical Co., Ltd.
Página inicialLista de ProdutoProdutos peptídicosTeriparatide Acetate 52232-67-4
Teriparatide Acetate 52232-67-4
  • Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

    Preço unitário: 1~1 USD
    Tipo de pagamento: T/T
    Incoterm: CIF
    Quantidade de pedido mínimo: 1 Kilogram
    Tempo de entrega: 15 dias

Informação básica

Modelo: 52232-67-4

Additional Info

Pacote: COMO REQUERIDO

produtividade: KGS

marca: VOLSENCHEM

transporte: Air

Lugar de origem: CHINA

Habilidade da fonte: TRUE MANUFACTURER

Certificados : GMP Peptide

Descrição do produto

Nós, China Teriparatide Acetato 52232-67-4 Fornecedores e China PTH (1-34) (humano) | Teriparatide Fabricantes, fornecer fragmento de hormona paratireóide China (1-34) produto e os produtos relacionados com a China PARATIREÓIDEO hormônio humano 1-34

Thera. Egory Cat: Pharmaceutical Peptide

Cas. No: 52232-67-4

Sinônimos: Paratormônio HUMANOS: Fragmento 1-34; A hormona paratiróide (HUMANO, 1-34); Hormona paratiróide (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Fórmula molecular: C172H278N52O47S2

Peso Molecular: 3.890,49792

Pureza: ≥98%

Embalagem: Exportação de embalagem digna

Material Safety Data Sheet: Disponível a pedido

Uso: A teriparatida é idêntica a uma porção da hormona humana parathyrod (PTH) e a utilização intermitente activa os osteoblastos mais do que osteoclates, o que leva a um aumento global no osso.

Grupo de Produto : Produtos peptídicos

Enviar e-mail para este fornecedor
  • Amy ChengMs. Amy Cheng
  • Sua mensagem deve estar entre 20-8000 caracteres

Lista de produtos relacionados