Comunique-se com o fornecedor? fornecedor
Amy Cheng Ms. Amy Cheng
O que posso fazer por você?
conversar Agora Fornecedor
Taizhou Volsen Chemical Co., Ltd.
Página inicialLista de ProdutoProdutos peptídicosHORMÔNIO PARATÍLRO (HUMANO, 1-34) 52232-67-4
HORMÔNIO PARATÍLRO (HUMANO, 1-34) 52232-67-4
  • HORMÔNIO PARATÍLRO (HUMANO, 1-34) 52232-67-4

HORMÔNIO PARATÍLRO (HUMANO, 1-34) 52232-67-4

    Preço unitário: USD 1 / Kilogram
    Tipo de pagamento: T/T
    Incoterm: CIF
    Quantidade de pedido mínimo: 1 Kilogram
    Tempo de entrega: 15 dias

Informação básica

Modelo: 52232-67-4

Additional Info

Pacote: COMO REQUERIDO

produtividade: KGS

marca: VOLSENCHEM

transporte: Air

Lugar de origem: CHINA

Habilidade da fonte: TRUE MANUFACTURER

Certificados : GMP Peptide

Descrição do produto

< Span style = "font-size: 9pt; font-family: Arial;">

Nós, China Teriparatide Acetate 52232-67-4 Fornecedores e China pTH (1-34) ( Humano) | Teriparatide fabricantes, fornecem China fragmento de hormônio paratireóide (1-34) produto E os produtos relacionados com China PARATHYROID HORMONE HUMAN 1-34

Thera. Cat egory: Péptido Farmacêutico

Cas No .: 52232-67-4 < Sinônimos < / Strong>: HORMÔNIO PARATÓROO HUMANO: FRAGMENTO 1-34 ; HORMÔNIO PARATÍRICO (HUMANO, 1-34) ; HORMÔNIO PARÁTICO (1-34), HUMANO ; PTH (1-34) (HUMAN) ; PTH (HUMANO, 1-34) ; TERIPARATIDE ; Teriparatide Acetato ; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

boa qualidade Poliméptido Hormonas Pó Teriparatida

Fórmula Molecular : C172H278N52O47S2 < / Span>
< / P>

Peso Molecular : < Span style = "font-family: Tahoma; line-height: normal; background-color: #FAFAFA;"> 3890.49792

Pureza: < / Strong> ≥98%

Embalagem : Exportar embalagem digna

Ficha de dados de segurança do material : Disponível a pedido < P> Uso: A teriparatida é idêntica a uma porção de hormônio paratireroduto humano (PTH) e uso intermitente ativam osteoblastos mais do que osteoclatos , o que leva a um Aumento geral do osso.

< / Span>

Grupo de Produto : Produtos peptídicos

Enviar e-mail para este fornecedor
  • Amy ChengMs. Amy Cheng
  • Sua mensagem deve estar entre 20-8000 caracteres

Lista de produtos relacionados