Taizhou Volsen Chemical Co., Ltd.
Página inicialLista de ProdutoProdutos peptídicosFragmento da hormona paratireóide (1-34) (CAS 52232-67-4)
Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)
  • Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)

Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)

    Preço unitário: USD 1 / Kilogram
    Tipo de pagamento: T/T
    Incoterm: CIF
    Quantidade de pedido mínimo: 1 Kilogram
    Tempo de entrega: 15 dias

Informação básica

Modelo: 52232-67-4

Additional Info

Pacote: COMO REQUERIDO

produtividade: KGS

marca: VOLSENCHEM

transporte: Air

Lugar de origem: CHINA

Habilidade da fonte: TRUE MANUFACTURER

Certificados : GMP Peptide

Descrição do produto


Nós somos um do acetato Teriparatide

CAS 52232-67-4 fornecedores no mercado chinês. A teriparatida é uma forma recombinante de hormônio paratireóide. É um agente eficaz de anabolizantes (isto é, crescimento ósseo) utilizado no tratamento de algumas formas de osteoporose e também ocasionalmente utilizado fora do rótulo para acelerar a cicatrização de fraturas. O acetato de teriparatida 52232-67-4 é conhecido por ação rápida, qualidade constante e alta pureza. Somos muito apreciados por muitos clientes que colaboramos.



Thera. Egory Cat: Pharmaceutical Peptide

Cas. No: 52232-67-4

Sinônimos: Paratormônio HUMANOS: Fragmento 1-34; A hormona paratiróide (HUMANO, 1-34); Hormona paratiróide (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Fórmula molecular: C172H278N52O47S2

Peso Molecular: 3.890,49792

Pureza: ≥98%

Embalagem: Exportação de embalagem digna

Material Safety Data Sheet: Disponível a pedido

Uso: no tratamento de algumas formas de osteoporose

Grupo de Produto : Produtos peptídicos

Enviar e-mail para este fornecedor
  • Amy ChengMs. Amy Cheng
  • Sua mensagem deve estar entre 20-8000 caracteres

Lista de produtos relacionados