Detalhes da empresa
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Tipo de Negócio:Fabricante
  • Main Mark: Americas , Ásia , leste Europeu , Europa , Norte da Europa , Outros Mercados , Europa Ocidental , No mundo todo
  • Exportador:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Descrição:Fragmento da hormona paratireóide 52232-67-4,Fragmento da hormona paratireóide CAS 52232-67-4,PTH 1-34 Humano
Taizhou Volsen Chemical Co., Ltd. Fragmento da hormona paratireóide 52232-67-4,Fragmento da hormona paratireóide CAS 52232-67-4,PTH 1-34 Humano
Casa > Lista de Produto > Produtos peptídicos > Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)

Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)

Compartilhar no:  
    Preço unitário: USD 1 / Kilogram
    Tipo de pagamento: T/T
    Incoterm: CIF
    Quantidade de pedido mínimo: 1 Kilogram
    Tempo de entrega: 15 dias

Informação básica

Modelo: 52232-67-4

Additional Info


produtividade: KGS


transporte: Air

Lugar de origem: CHINA

Habilidade da fonte: TRUE MANUFACTURER

Certificados : GMP Peptide

Descrição do produto

Nós somos um do acetato Teriparatide

CAS 52232-67-4 fornecedores no mercado chinês. A teriparatida é uma forma recombinante de hormônio paratireóide. É um agente eficaz de anabolizantes (isto é, crescimento ósseo) utilizado no tratamento de algumas formas de osteoporose e também ocasionalmente utilizado fora do rótulo para acelerar a cicatrização de fraturas. O acetato de teriparatida 52232-67-4 é conhecido por ação rápida, qualidade constante e alta pureza. Somos muito apreciados por muitos clientes que colaboramos.

Thera. Egory Cat: Pharmaceutical Peptide

Cas. No: 52232-67-4

Sinônimos: Paratormônio HUMANOS: Fragmento 1-34; A hormona paratiróide (HUMANO, 1-34); Hormona paratiróide (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF


Fórmula molecular: C172H278N52O47S2

Peso Molecular: 3.890,49792

Pureza: ≥98%

Embalagem: Exportação de embalagem digna

Material Safety Data Sheet: Disponível a pedido

Uso: no tratamento de algumas formas de osteoporose

Grupo de Produto : Produtos peptídicos

imagem de Produto
  • Fragmento da hormona paratireóide (1-34) (CAS 52232-67-4)
Enviar e-mail para este fornecedor
  • *Assunto:
  • *Mensagens:
    Sua mensagem deve estar entre 20-8000 caracteres

Mobile site índice. Mapa do Site

Assine a nossa newsletter:
Receba as atualizações, Ofertas Especiais, grandes Prêmios, descontos

Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Todos os direitos reservados.
Comunique-se com o fornecedor?fornecedor
Amy Cheng Ms. Amy Cheng
O que posso fazer por você?
conversar Agora Fornecedor